SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|341914709|ref|XP_003403848.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|341914709|ref|XP_003403848.1|
Domain Number - Region: 530-558
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00175
Family EGF-type module 0.053
Further Details:      
 
Domain Number - Region: 559-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0027
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|341914709|ref|XP_003403848.1|
Sequence length 771
Comment PREDICTED: LOW QUALITY PROTEIN: mucin-3B [Homo sapiens]
Sequence
MSSIITTETTSHSTPSFTSSTIHSTVSSSTTAITSPFTTAETGVTSTPSSPSSLSTDIPT
TSLRTLTPLSLSTSTSLTTTTDLPSIPTDISSLPTPIHIISSSPSIQSTETSSLVGTTSP
TMSTVRATLRSTENTPISSFSTSIVVTPETPTTQAPPVLMSATGTQTSPVPTTVTFGSMD
SSTSTLHTLTPSTALSKIMSTSQFPIPSTHSSTLQTTPSIPSLQTSLTSTSEFTTESFTR
GSTSTNAILTSFSTIIWSSTPTIIMSSSPSSASITPVFATTIHSVPSSPYIFSTENVGSA
SITAFPSLSSSSTTSTSPTSSSLTTALTEITPFSYISLPSTTPCPGTITITIVPASPTDP
CVEMDPSTEATSPPTTPLTVFPFTTEMVTCPSSISMQTTLATHMDTSSMTPESESSIIPN
ASSSTGTGTVPTNTVFTSTRLPTSETWLSNNSVIPTPLPGVSTIPLTMKPSSSLPTILRT
SSKSTHPSPPTARTSETSVATTQTPTTLTTRRTTPITSWMTTQSTLTTTAGTCDNGGTWE
QGQCACLPGFSGDRCQLQTRCQNGGQWDGLKCQCPSTFYGSSCEFAVEQVDLGEXPELCL
LHFLPQGVTNSPQTYPSGSLVFQMQKIFADMQGFTFKGVEILSLRNGSIVVDYLVLLEMP
FSPQLESEYEQVKTTLKEGLQNASQDANSCQDSQTLCFKPDSIKVNNNSKTELTPEAICR
RAAPTGYEEFYFPLVEATRLRCVTKCTSGVDNAIDCHQGQCVLETSGPACR
Download sequence
Identical sequences gi|341914709|ref|XP_003403848.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]