SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|341914871|ref|XP_003403880.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|341914871|ref|XP_003403880.1|
Domain Number - Region: 873-901
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00222
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 844-872
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00257
Family EGF-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|341914871|ref|XP_003403880.1|
Sequence length 909
Comment PREDICTED: mucin-3A, partial [Homo sapiens]
Sequence
ITTSETPSHRTPSFTSSITTTETPSSSTPSFTSSITTTETTSHSTPSFTSSISTTETTSH
STPSFTSLITITETTSHSTPSYTTSITTTETPSHSTPSYTTSITTTETPSHSTPSFTSSI
TTTETTSHSTPSFTSSIRTTETTSYSTPSFTSSNTITETTSHSTPSYITSITTTETPSSS
TPSFSSSITTTETTSHSTPGFTSSITTTETTSHSTPSFTSSITTTETTSHDTPSFTSSIT
TSETPSHSTPSSTSLITTTKTTSHSTPSFTSSITTTETTSHSAHSFTSSITTTETTSHNT
RSFTSSITTTETNSHSTTSFTSSITTTETTSHSTPSFSSSITTTETXXXXXXXTSETAVT
PTPVTPSSLSTDIPTTSLRTLTPSSVGTSTSLTTTTDFPSIPTDISTLPTRTHIISSSPS
IQSTETSSLVGTTSPTMSTVRMTLRITENTPISSFSTSIVVIPETPTQTPPVLTSATGTQ
TSPAPTTVTFGSTDSSTSTLHTLTPSTALSTIVSTSQVPIPSTHSSTLQTTPSTPSLQTS
LTSTSEFTTESFTRGSTSTNAILTSFSTIIWSSTPTIIMSSSPSSASITPVFSTTIHSVP
SSPYIFSTENVGSASITGFPSLSSSATTSTSSTSSSLTTALTEITPFSYISLPSTTPCPG
TITITIVPASPTDPCVEMDPSTEATSPPTTPLTVFPFTTEMVTCPTSISIQTTLTTYMDT
SSMMPESESSISPNASSSTGTGTVPTNTVFTSTRLPTSETWLSNSSVIPLPLPGVSTIPL
TMKPSSSLPTILRTSSKSTHPSPPTTRTSETPVATTQTPTTLTSRRTTRITSQMTTQSTL
TTTAGTCDNGGTWEQGQCACLPGFSGDRCQLQTRCQNGGQWDGLKCQCPSTFYGSSCEFA
VEQVDLGCH
Download sequence
Identical sequences gi|341914871|ref|XP_003403880.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]