SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|341916253|ref|XP_003403665.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|341916253|ref|XP_003403665.1|
Domain Number 1 Region: 274-425
Classification Level Classification E-value
Superfamily PH domain-like 4.37e-36
Family Phosphotyrosine-binding domain (PTB) 0.0054
Further Details:      
 
Domain Number 2 Region: 213-266
Classification Level Classification E-value
Superfamily SH3-domain 0.000000479
Family SH3-domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|341916253|ref|XP_003403665.1|
Sequence length 433
Comment PREDICTED: c-Jun-amino-terminal kinase-interacting protein 1-like [Homo sapiens]
Sequence
MLQMDLIDATGDTPGAEDDEEDDDEERAARRPGAGPPKAESGQEPASRGQGQSQGQSQGP
GSGDTYRPKRPTTLNLFPQVQLSQDTLNNNSLGKKSRHLHQQPTLLVDEHAQLELVSLRP
CFGDYSDESDSAIVYDNCVSVSSPYESAIGEEYEEASRPQPPACLSKDSTPDEPDVHFSK
KFLNIFMSGRSRSSSAESFGLFSCIINREEQEQTHRTIFRFVPRHEDEPELEVDDPLLVE
LQAEDYWYEAYNMRTGARGFFTAYYAIEVTKEPEHMAALAKNSDWVDQFRVKFLGSVQVP
YHKGDVVLSAAMQKIATTRRLTVHFNPPSSCVLEISVRGVKIGVKADDSQEAKGNKCSHF
FQLKNISFRGYHPKNNKYFGFITKHLADHRFACHVFVSEDSTKALAESVGRAFQQFHKQF
VEYTCPTEDIYLE
Download sequence
Identical sequences gi|341916251|ref|XP_003403664.1| gi|341916253|ref|XP_003403665.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]