SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|34304377|ref|NP_149348.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|34304377|ref|NP_149348.2|
Domain Number 1 Region: 35-357
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.95e-123
Family Bee venom hyaluronidase 0.00000919
Further Details:      
 
Weak hits

Sequence:  gi|34304377|ref|NP_149348.2|
Domain Number - Region: 423-443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00171
Family EGF-type module 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|34304377|ref|NP_149348.2|
Sequence length 473
Comment hyaluronidase-2 precursor [Homo sapiens]
Sequence
MRAGPGPTVTLALVLAVSWAMELKPTAPPIFTGRPFVVAWDVPTQDCGPRLKVPLDLNAF
DVQASPNEGFVNQNITIFYRDRLGLYPRFDSAGRSVHGGVPQNVSLWAHRKMLQKRVEHY
IRTQESAGLAVIDWEDWRPVWVRNWQDKDVYRRLSRQLVASRHPDWPPDRIVKQAQYEFE
FAAQQFMLETLRYVKAVRPRHLWGFYLFPDCYNHDYVQNWESYTGRCPDVEVARNDQLAW
LWAESTALFPSVYLDETLASSRHGRNFVSFRVQEALRVARTHHANHALPVYVFTRPTYSR
RLTGLSEMDLISTIGESAALGAAGVILWGDAGYTTSTETCQYLKDYLTRLLVPYVVNVSW
ATQYCSRAQCHGHGRCVRRNPSASTFLHLSTNSFRLVPGHAPGEPQLRPVGELSWADIDH
LQTHFRCQCYLGWSGEQCQWDHRQAAGGASEAWAGSHLTSLLALAALAFTWTL
Download sequence
Identical sequences Q12891
ENSP00000350387 ENSP00000378571 ENSP00000401853 ENSP00000406657 ENSP00000458862 ENSP00000460851 ENSP00000460938 ENSP00000461372 ENSP00000350387 ENSP00000458862 ENSP00000350387 ENSP00000378571 ENSP00000401853 ENSP00000406657 gi|15022801|ref|NP_003764.3| gi|34304377|ref|NP_149348.2| 9606.ENSP00000350387 NP_003764.3.87134 NP_003764.3.92137 NP_149348.2.87134 NP_149348.2.92137 XP_005265581.1.92137 XP_005265582.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]