SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|34577057|ref|NP_037412.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|34577057|ref|NP_037412.2|
Domain Number 1 Region: 100-372
Classification Level Classification E-value
Superfamily L domain-like 1.79e-48
Family Ngr ectodomain-like 0.0036
Further Details:      
 
Domain Number 2 Region: 53-120
Classification Level Classification E-value
Superfamily L domain-like 0.000000544
Family Ngr ectodomain-like 0.0037
Further Details:      
 
Domain Number 3 Region: 441-510
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000112
Family Fibronectin type III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|34577057|ref|NP_037412.2|
Sequence length 674
Comment leucine-rich repeat transmembrane protein FLRT1 [Homo sapiens]
Sequence
MVVAHPTATATTTPTATVTATVVMTTATMDLRDWLFLCYGLIAFLTEVIDSTTCPSVCRC
DNGFIYCNDRGLTSIPADIPDDATTLYLQNNQINNAGIPQDLKTKVNVQVIYLYENDLDE
FPINLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLK
LLFLSRNHLSSIPSGLPHTLEELRLDDNRISTIPLHAFKGLNSLRRLVLDGNLLANQRIA
DDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELERLD
LSNNNLTTLPRGLFDDLGNLAQLLLRNNPWFCGCNLMWLRDWVKARAAVVNVRGLMCQGP
EKVRGMAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAKRPGLR
LPDSNIDYPMATGDGAKTLAIHVKALTADSIRITWKATLPASSFRLSWLRLGHSPAVGSI
TETLVQGDKTEYLLTALEPKSTYIICMVTMETSNAYVADETPVCAKAETADSYGPTTTLN
QEQNAGPMASLPLAGIIGGAVALVFLFLVLGAICWYVHQAGELLTRERAYNRGSRKKDDY
MESGTKKDNSILEIRGPGLQMLPINPYRAKEEYVVHTIFPSNGSSLCKATHTIGYGTTRG
YRDGGIPDIDYSYT
Download sequence
Identical sequences ENSP00000246841 gi|34577057|ref|NP_037412.2| ENSP00000246841 NP_037412.2.87134 NP_037412.2.92137 XP_005273918.1.92137 XP_011543185.1.92137 9606.ENSP00000246841 ENSP00000246841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]