SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|34734062|ref|NP_001987.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|34734062|ref|NP_001987.2|
Domain Number 1 Region: 293-446
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.2e-17
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 444-576
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000832
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 182-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000838
Family EGF-type module 0.021
Further Details:      
 
Domain Number 4 Region: 216-273
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000104
Family EGF-type module 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|34734062|ref|NP_001987.2|
Sequence length 683
Comment fibulin-1 isoform C precursor [Homo sapiens]
Sequence
MERAAPSRRVPLPLLLLGGLALLAAGVDADVLLEACCADGHRMATHQKDCSLPYATESKE
CRMVQEQCCHSQLEELHCATGISLANEQDRCATPHGDNASLEATFVKRCCHCCLLGRAAQ
AQGQSCEYSLMVGYQCGQVFRACCVKSQETGDLDVGGLQETDKIIEVEEEQEDPYLNDRC
RGGGPCKQQCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSF
RCQRDSSCGTGYELTEDNSCKDIDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQ
DALGNCIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDEC
APPAEPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNECQRYPGRLCGHKCENTLG
SYLCSCSVGFRLSVDGRSCEDINECSSSPCSQECANVYGSYQCYCRRGYQLSDVDGVTCE
DIDECALPTGGHICSYRCINIPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINE
TCFNIQGGFRCLAFECPENYRRSAATRCERLPCHENRECSKLPLRITYYHLSFPTNIQAP
AVVFRMGPSSAVPGDSMQLAITGGNEEGFFTTRKVSPHSGVVALTKPVPEPRDLLLTVKM
DLSRHGTVSSFVAKLFIFVSAEL
Download sequence
Identical sequences gi|34734062|ref|NP_001987.2| NP_001987.2.87134 NP_001987.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]