SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|34734066|ref|NP_006477.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|34734066|ref|NP_006477.2|
Domain Number 1 Region: 358-482
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.8e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 2 Region: 217-356
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000714
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 3 Region: 478-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000276
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 4 Region: 182-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000318
Family EGF-type module 0.021
Further Details:      
 
Domain Number 5 Region: 524-563
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000869
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|34734066|ref|NP_006477.2|
Sequence length 703
Comment fibulin-1 isoform D precursor [Homo sapiens]
Sequence
MERAAPSRRVPLPLLLLGGLALLAAGVDADVLLEACCADGHRMATHQKDCSLPYATESKE
CRMVQEQCCHSQLEELHCATGISLANEQDRCATPHGDNASLEATFVKRCCHCCLLGRAAQ
AQGQSCEYSLMVGYQCGQVFRACCVKSQETGDLDVGGLQETDKIIEVEEEQEDPYLNDRC
RGGGPCKQQCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSF
RCQRDSSCGTGYELTEDNSCKDIDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQ
DALGNCIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDEC
APPAEPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNECQRYPGRLCGHKCENTLG
SYLCSCSVGFRLSVDGRSCEDINECSSSPCSQECANVYGSYQCYCRRGYQLSDVDGVTCE
DIDECALPTGGHICSYRCINIPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINE
TCFNIQGGFRCLAFECPENYRRSAATLQQEKTDTVRCIKSCRPNDVTCVFDPVHTISHTV
ISLPTFREFTRPEEIIFLRAITPPHPASQANIIFDITEGNLRDSFDIIKRYMDGMTVGVV
RQVRPIVGPFHAVLKLEMNYVVGGVVSHRNVVNVHIFVSEYWF
Download sequence
Identical sequences gi|34734066|ref|NP_006477.2| NP_006477.2.87134 NP_006477.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]