SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|34734068|ref|NP_006478.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|34734068|ref|NP_006478.2|
Domain Number 1 Region: 340-447
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000133
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 397-525
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000298
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 182-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000136
Family EGF-type module 0.021
Further Details:      
 
Domain Number 4 Region: 247-357
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000282
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 5 Region: 517-561
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000055
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|34734068|ref|NP_006478.2|
Sequence length 566
Comment fibulin-1 isoform A precursor [Homo sapiens]
Sequence
MERAAPSRRVPLPLLLLGGLALLAAGVDADVLLEACCADGHRMATHQKDCSLPYATESKE
CRMVQEQCCHSQLEELHCATGISLANEQDRCATPHGDNASLEATFVKRCCHCCLLGRAAQ
AQGQSCEYSLMVGYQCGQVFRACCVKSQETGDLDVGGLQETDKIIEVEEEQEDPYLNDRC
RGGGPCKQQCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSF
RCQRDSSCGTGYELTEDNSCKDIDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQ
DALGNCIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDEC
APPAEPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNECQRYPGRLCGHKCENTLG
SYLCSCSVGFRLSVDGRSCEDINECSSSPCSQECANVYGSYQCYCRRGYQLSDVDGVTCE
DIDECALPTGGHICSYRCINIPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINE
TCFNIQGGFRCLAFECPENYRRSAAT
Download sequence
Identical sequences gi|34734068|ref|NP_006478.2| NYSGRC-34734068 NP_006478.2.87134 NP_006478.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]