SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37537704|ref|NP_932066.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37537704|ref|NP_932066.1|
Domain Number 1 Region: 57-152
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.31e-30
Family Thioltransferase 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37537704|ref|NP_932066.1|
Sequence length 164
Comment glutaredoxin-2, mitochondrial isoform 2 [Homo sapiens]
Sequence
MIWRRAALAGTRLVWSRSGSAGWLDRAAGAAGAAAAAASGMESNTSSSLENLATAPVNQI
QETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERT
VPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ
Download sequence
Identical sequences Q9NS18
NP_932066.1.87134 NP_932066.1.92137 gi|37537704|ref|NP_932066.1| ENSP00000356409 ENSP00000356409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]