SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|38146012|ref|NP_938051.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38146012|ref|NP_938051.1|
Domain Number 1 Region: 219-491
Classification Level Classification E-value
Superfamily TPR-like 3.45e-29
Family Tetratricopeptide repeat (TPR) 0.0059
Further Details:      
 
Weak hits

Sequence:  gi|38146012|ref|NP_938051.1|
Domain Number - Region: 9-50
Classification Level Classification E-value
Superfamily TPR-like 0.00522
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 
Domain Number - Region: 159-221
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0557
Family Phosphate binding protein-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|38146012|ref|NP_938051.1|
Sequence length 505
Comment tetratricopeptide repeat protein 8 isoform B [Homo sapiens]
Sequence
MSSEMEPLLLAWSYFRRRKFQLCADLCTQMLEKSPYDQAAWILKARALTEMVYIDEIDVD
QEGIAEMMLDENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSG
RPGTMEQAIRTPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRLNLTKYSQKPK
LAKALFEYIFHHENDVKTALDLAALSTEHSQYKDWWWKVQIGKCYYRLGMYREAEKQFKS
ALKQQEMVDTFLYLAKVYVSLDQPVTALNLFKQGLDKFPGEVTLLCGIARIYEEMNNMSS
AAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEIALRFYRRLLQMGIYNGQLFNNLGLCC
FYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHVAVGIGDTNLAHQCFRLALVNNNNH
AEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATISDKIGDLQRSYVAAQK
SEAAFPDHVDTQHLIKQLRQHFAML
Download sequence
Identical sequences A0A0C4DGY3
ENSP00000482721 NP_938051.1.87134 NP_938051.1.92137 XP_006720098.1.92137 HR5649 ENSP00000339486 gi|38146012|ref|NP_938051.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]