SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|38569428|ref|NP_942093.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38569428|ref|NP_942093.1|
Domain Number 1 Region: 18-301
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.71e-51
Family Ankyrin repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 497-643
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.34e-37
Family Ankyrin repeat 0.00039
Further Details:      
 
Domain Number 3 Region: 333-400
Classification Level Classification E-value
Superfamily EF-hand 0.000000124
Family Calmodulin-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|38569428|ref|NP_942093.1|
Sequence length 776
Comment ankyrin repeat domain-containing protein 5 [Homo sapiens]
Sequence
MALADKRLENLQIYKVLQCVRNKDKKQIEKLTKLGYPELINYTEPINGLSALHLASVSND
IDMVSFLLDLGAHPDVQDRMGCTPTMRAAELGHELSMEILAKAKADMTIVDNEGKGVLFY
CILPTKRHYRCALIALEHGADVNNSTYEGKPIFLRACEDAHDVKDVCLTFLEKGANPNAI
NSSTGRTALMEASREGVVEIVRGILERGGEVNAFDNDRHHAAHFAAKGGFFDILKLLFAY
NGDVGLISINGNTPLHYAAMGGFADCCKYIAQRGCDLKWKNLDHKTPRAVAKEGGFKAAS
KEIRRAERIANKLARPGAKNPNPLWALRLHDWSVEREAFLREAFAVLDRGDGSISKNDFV
MVLEERQDYASSEQLAAIAHLHEKTRGGGVNINEFFKGTRYLNKSFVLGSYGPKKKEKGM
GKKGKKGKFVLPLPICVIPEYAFPRRQDGGPPYYMIETYKNVTDSSRFNRDHPPEHPIQD
DSVWYIDDSEKVFSNINIITKAGDLASLKKAFESGIPVDMKDNYYKTPLMTACASGNIDV
VKFLLEKGANVNATDNFLWTPLHFACHAGQQDIVELLVESGALIDAASINNSTPLNRAIE
SCRLDTVKYLLDIGAKFQLENRKGHSAMDVAKAYADYRIIDLIKEKLDNLPKPAENQKLK
GKTPPILKTEGPEIKKEEELLSSIYGVPTTSEGKKVQKGNVVHLNSLITSGYTKKVDITF
IPRRIWSPEATTAELIRKRELRRERFTHEVDFDDFMMPFQKNITEKARALEAALKT
Download sequence
Identical sequences Q9NU02
NP_071379.3.87134 NP_071379.3.92137 NP_942093.1.87134 NP_942093.1.92137 ENSP00000367631 gi|38569426|ref|NP_071379.3| gi|38569428|ref|NP_942093.1| ENSP00000367631 ENSP00000367644 ENSP00000367631 ENSP00000367644 9606.ENSP00000367631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]