SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|38570107|ref|NP_073622.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38570107|ref|NP_073622.2|
Domain Number 1 Region: 1320-1393,1439-1499
Classification Level Classification E-value
Superfamily EF-hand 8.85e-24
Family Calmodulin-like 0.02
Further Details:      
 
Domain Number 2 Region: 73-135,172-239
Classification Level Classification E-value
Superfamily EF-hand 1.06e-23
Family Calmodulin-like 0.011
Further Details:      
 
Domain Number 3 Region: 736-811,852-911
Classification Level Classification E-value
Superfamily EF-hand 2.99e-23
Family Calmodulin-like 0.025
Further Details:      
 
Domain Number 4 Region: 1060-1139,1181-1240
Classification Level Classification E-value
Superfamily EF-hand 1.19e-21
Family EF-hand modules in multidomain proteins 0.00016
Further Details:      
 
Domain Number 5 Region: 297-367,408-475
Classification Level Classification E-value
Superfamily EF-hand 5.93e-19
Family Calmodulin-like 0.021
Further Details:      
 
Domain Number 6 Region: 507-586,639-689
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000315
Family Calmodulin-like 0.053
Further Details:      
 
Domain Number 7 Region: 956-1029
Classification Level Classification E-value
Superfamily EF-hand 0.0000000463
Family Calmodulin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|38570107|ref|NP_073622.2|
Sequence length 1501
Comment EF-hand calcium-binding domain-containing protein 6 isoform a [Homo sapiens]
Sequence
MCKMAIIPDWLRSHPHTRKFTHSRPHSSPCRVYSRNGSPNKFRSSSTTAVANPTLSSLDV
KRILFQKITDRGDELQKAFQLLDTGQNLTVSKSELRRIITDFLMPLTREQFQDVLAQIPL
STSGTVPYLAFLSRFGGIDLYINGIKRGGGNEMNCCRTLRELEIQVGEKVFKNIKTVMKA
FELIDVNKTGLVRPQELRRVLETFCMKLRDEEYEKFSKHYNIHKDTAVDYNVFLKNLSIN
NDLNLRYCMGNQEVSLENQQAKNSKKERLLGSASSEDIWRNYSLDEIERNFCLQLSKSYE
KVEKALSAGDPCKGGYVSFNYLKIVLDTFVYQIPRRIFIQLMKRFGLKATTKINWKQFLT
SFHEPQGLQVSSKGPLTKRNSINSRNESHKENIITKLFRHTEDHSASLKKALLIINTKPD
GPITREEFRYILNCMAVKLSDSEFKELMQMLDPGDTGVVNTSMFIDLIEENCRMRKTSPC
TDAKTPFLLAWDSVEEIVHDTITRNLQAFYNMLRSYDLGDTGRIGRNNFKKIMHVFCPFL
TNAHFIKLCSKIQDIGSGRILYKKLLACIGIDGPPTVSPVLVPKDQLLSEHLQKDEQQQP
DLSERTKLTEDKTTLTKKMTTEEVIEKFKKCIQQQDPAFKKRFLDFSKEPNGKINVHDFK
KVLEDTGMPMDDDQYALLTTKIGFEKEGMSYLDFAAGFEDPPMRGPETTPPQPPTPSKSY
VNSHFITAEECLKLFPRRLKESFRDPYSAFFKTDADRDGIINMHDLHRLLLHLLLNLKDD
EFERFLGLLGLRLSVTLNFREFQNLCEKRPWRTDEAPQRLIRPKQKVADSELACEQAHQY
LVTKAKNRWSDLSKNFLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYDTEGK
GHITYQEFLQKLGINYSPAVHRPCAEDYFNFMGHFTKPQQLQEEMKELQQSTEKAVAARD
KLMDRHQDISKAFTKTDQSKTNYISICKMQEVLEECGCSLTEGELTHLLNSWGVSRHDNA
INYLDFLRAVENSKSTGAQPKEKEESMPINFATLNPQEAVRKIQEVVESSQLALSTAFSA
LDKEDTGFVKATEFGQVLKDFCYKLTDNQYHYFLRKLRIHLTPYINWKYFLQNFSCFLEE
TADEWAEKMPKGPPPTSPKATADRDILARLHKAVTSHYHAITQEFENFDTMKTNTISREE
FRAICNRRVQILTDEQFDRLWNEMPVNAKGRLKYPDFLSRFSSETAATPMATGDSAVAQR
GSSVPDVSEGTRSALSLPTQELRPGSKSQSHPCTPASTTVIPGTPPLQNCDPIESRLRKR
IQGCWRQLLKECKEKDVARQGDINASDFLALVEKFNLDISKEECQQLIIKYDLKSNGKFA
YCDFIQSCVLLLKAKESSLMHRMKIQNAHKMKEAGAETPSFYSALLRIQPKIVHCWRPMR
RTFKSYDEAGTGLLSVADFRTVLRQYSINLSEEEFFHILEYYDKTLSSKISYNDFLRAFL
Q
Download sequence
Identical sequences Q5THR3
ENSP00000262726 ENSP00000262726 9606.ENSP00000262726 ENSP00000348391 gi|38570107|ref|NP_073622.2| NP_073622.2.87134 NP_073622.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]