SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|38570109|ref|NP_942153.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38570109|ref|NP_942153.1|
Domain Number 1 Region: 1168-1241,1287-1347
Classification Level Classification E-value
Superfamily EF-hand 7.56e-24
Family Calmodulin-like 0.02
Further Details:      
 
Domain Number 2 Region: 584-659,700-759
Classification Level Classification E-value
Superfamily EF-hand 2.57e-23
Family Calmodulin-like 0.025
Further Details:      
 
Domain Number 3 Region: 908-987,1029-1088
Classification Level Classification E-value
Superfamily EF-hand 9.75e-22
Family EF-hand modules in multidomain proteins 0.00016
Further Details:      
 
Domain Number 4 Region: 144-215,256-324
Classification Level Classification E-value
Superfamily EF-hand 4.81e-19
Family Calmodulin-like 0.021
Further Details:      
 
Domain Number 5 Region: 355-434,487-537
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000261
Family Calmodulin-like 0.053
Further Details:      
 
Domain Number 6 Region: 8-85
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000198
Family Calmodulin-like 0.052
Further Details:      
 
Domain Number 7 Region: 804-877
Classification Level Classification E-value
Superfamily EF-hand 0.0000000383
Family Calmodulin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|38570109|ref|NP_942153.1|
Sequence length 1349
Comment EF-hand calcium-binding domain-containing protein 6 isoform b [Homo sapiens]
Sequence
MNCCRTLRELEIQVGEKVFKNIKTVMKAFELIDVNKTGLVRPQELRRVLETFCMKLRDEE
YEKFSKHYNIHKDTAVDYNVFLKNLSINNDLNLRYCMGNQEVSLENQQAKNSKKERLLGS
ASSEDIWRNYSLDEIERNFCLQLSKSYEKVEKALSAGDPCKGGYVSFNYLKIVLDTFVYQ
IPRRIFIQLMKRFGLKATTKINWKQFLTSFHEPQGLQVSSKGPLTKRNSINSRNESHKEN
IITKLFRHTEDHSASLKKALLIINTKPDGPITREEFRYILNCMAVKLSDSEFKELMQMLD
PGDTGVVNTSMFIDLIEENCRMRKTSPCTDAKTPFLLAWDSVEEIVHDTITRNLQAFYNM
LRSYDLGDTGRIGRNNFKKIMHVFCPFLTNAHFIKLCSKIQDIGSGRILYKKLLACIGID
GPPTVSPVLVPKDQLLSEHLQKDEQQQPDLSERTKLTEDKTTLTKKMTTEEVIEKFKKCI
QQQDPAFKKRFLDFSKEPNGKINVHDFKKVLEDTGMPMDDDQYALLTTKIGFEKEGMSYL
DFAAGFEDPPMRGPETTPPQPPTPSKSYVNSHFITAEECLKLFPRRLKESFRDPYSAFFK
TDADRDGIINMHDLHRLLLHLLLNLKDDEFERFLGLLGLRLSVTLNFREFQNLCEKRPWR
TDEAPQRLIRPKQKVADSELACEQAHQYLVTKAKNRWSDLSKNFLETDNEGNGILRRRDI
KNALYGFDIPLTPREFEKLWARYDTEGKGHITYQEFLQKLGINYSPAVHRPCAEDYFNFM
GHFTKPQQLQEEMKELQQSTEKAVAARDKLMDRHQDISKAFTKTDQSKTNYISICKMQEV
LEECGCSLTEGELTHLLNSWGVSRHDNAINYLDFLRAVENSKSTGAQPKEKEESMPINFA
TLNPQEAVRKIQEVVESSQLALSTAFSALDKEDTGFVKATEFGQVLKDFCYKLTDNQYHY
FLRKLRIHLTPYINWKYFLQNFSCFLEETADEWAEKMPKGPPPTSPKATADRDILARLHK
AVTSHYHAITQEFENFDTMKTNTISREEFRAICNRRVQILTDEQFDRLWNEMPVNAKGRL
KYPDFLSRFSSETAATPMATGDSAVAQRGSSVPDVSEGTRSALSLPTQELRPGSKSQSHP
CTPASTTVIPGTPPLQNCDPIESRLRKRIQGCWRQLLKECKEKDVARQGDINASDFLALV
EKFNLDISKEECQQLIIKYDLKSNGKFAYCDFIQSCVLLLKAKESSLMHRMKIQNAHKMK
EAGAETPSFYSALLRIQPKIVHCWRPMRRTFKSYDEAGTGLLSVADFRTVLRQYSINLSE
EEFFHILEYYDKTLSSKISYNDFLRAFLQ
Download sequence
Identical sequences gi|38570109|ref|NP_942153.1| ENSP00000379533 ENSP00000379533 NP_942153.1.87134 NP_942153.1.92137 NYSGRC-38570109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]