SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|38788243|ref|NP_037394.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38788243|ref|NP_037394.2|
Domain Number 1 Region: 183-306
Classification Level Classification E-value
Superfamily PH domain-like 2.18e-26
Family Third domain of FERM 0.0048
Further Details:      
 
Domain Number 2 Region: 84-180
Classification Level Classification E-value
Superfamily Second domain of FERM 1.03e-23
Family Second domain of FERM 0.001
Further Details:      
 
Domain Number 3 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.12e-20
Family First domain of FERM 0.0018
Further Details:      
 
Domain Number 4 Region: 381-430
Classification Level Classification E-value
Superfamily RING/U-box 0.00000565
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|38788243|ref|NP_037394.2|
Sequence length 445
Comment E3 ubiquitin-protein ligase MYLIP [Homo sapiens]
Sequence
MLCYVTRPDAVLMEVEVEAKANGEDCLNQVCRRLGIIEVDYFGLQFTGSKGESLWLNLRN
RISQQMDGLAPYRLKLRVKFFVEPHLILQEQTRHIFFLHIKEALLAGHLLCSPEQAVELS
ALLAQTKFGDYNQNTAKYNYEELCAKELSSATLNSIVAKHKELEGTSQASAEYQVLQIVS
AMENYGIEWHSVRDSEGQKLLIGVGPEGISICKDDFSPINRIAYPVVQMATQSGKNVYLT
VTKESGNSIVLLFKMISTRAASGLYRAITETHAFYRCDTVTSAVMMQYSRDLKGHLASLF
LNENINLGKKYVFDIKRTSKEVYDHARRALYNAGVVDLVSRNNQSPSHSPLKSSESSMNC
SSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCESCAAQLQSCPV
CRSRVEHVQHVYLPTHTSLLNLTVI
Download sequence
Identical sequences Q8WY64
9606.ENSP00000349298 gi|38788243|ref|NP_037394.2| ENSP00000008686 NP_037394.2.87134 NP_037394.2.92137 HR5617 ENSP00000349298 ENSP00000349298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]