SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|39777606|ref|NP_945353.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|39777606|ref|NP_945353.1|
Domain Number 1 Region: 59-248
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.06e-70
Family Regulator of G-protein signaling, RGS 0.00000000579
Further Details:      
 
Domain Number 2 Region: 411-639
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.95e-61
Family DBL homology domain (DH-domain) 0.000000601
Further Details:      
 
Domain Number 3 Region: 640-774
Classification Level Classification E-value
Superfamily PH domain-like 2.56e-38
Family Pleckstrin-homology domain (PH domain) 0.0000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|39777606|ref|NP_945353.1|
Sequence length 927
Comment rho guanine nucleotide exchange factor 1 isoform 1 [Homo sapiens]
Sequence
MASLSTWSSPAEPREMEDFARGAASPGPSRPGLVPVSIIGAEDEDFENELETNSEEQNSQ
FQSLEQVKRRPAHLMALLQHVALQFEPGPLLCCLHADMLGSLGPKEAKKAFLDFYHSFLE
KTAVLRVPVPPNVAFELDRTRADLISEDVQRRFVQEVVQSQQVAVGRQLEDFRSKRLMGM
TPWEQELAQLEAWVGRDRASYEARERHVAERLLMHLEEMQHTISTDEEKSAAVVNAIGLY
MRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPAKTKKGLSSILDAARWNRGEPQVPDFR
HLKAEVDAEKPGATDRKGGVGMPSRDRNIGAPGQDTPGVSLHPLSLDSPDREPGADAPLE
LGDSSPQGPMSLESLAPPESTDEGAETESPEPGDEGEPGRSGLELEPEEPPGWRELVPPD
TLHSLPKSQVKRQEVISELLVTEAAHVRMLRVLHDLFFQPMAECLFFPLEELQNIFPSLD
ELIEVHSLFLDRLMKRRQESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQ
LKAKQRKDPRFCAFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPTER
EKVELAAECCREILHHVNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFKNLDITK
KKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLR
PVLRLTSAMTREVATDHKAFYVLFTWDQEAQIYELVAQTVSERKNWCALITETAGSLKVP
APASRPKPRPSPSSTREPLLSSSENGNGGRETSPADARTERILSDLLPFCRPGPEGQLAA
TALRKVLSLKQLLFPAEEDNGAGPPRDGDGVPGGGPLSPARTQEIQENLLSLEETMKQLE
ELEEEFCRLRPLLSQLGGNSVPQPGCT
Download sequence
Identical sequences gi|39777606|ref|NP_945353.1| NP_945353.1.87134 NP_945353.1.92137 ENSP00000337261 ENSP00000476895 9606.ENSP00000337261 ENSP00000337261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]