SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|39930401|ref|NP_065902.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|39930401|ref|NP_065902.1|
Domain Number 1 Region: 42-229
Classification Level Classification E-value
Superfamily L domain-like 9.35e-41
Family Ngr ectodomain-like 0.0091
Further Details:      
 
Domain Number 2 Region: 253-292,320-374
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000283
Family V set domains (antibody variable domain-like) 0.066
Further Details:      
 
Weak hits

Sequence:  gi|39930401|ref|NP_065902.1|
Domain Number - Region: 530-569
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00607
Family Fibronectin type III 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|39930401|ref|NP_065902.1|
Sequence length 745
Comment immunoglobulin superfamily containing leucine-rich repeat protein 2 precursor [Homo sapiens]
Sequence
MFPLRALWLVWALLGVAGSCPEPCACVDKYAHQFADCAYKELREVPEGLPANVTTLSLSA
NKITVLRRGAFADVTQVTSLWLAHNEVRTVEPGALAVLSQLKNLDLSHNFISSFPWSDLR
NLSALQLLKMNHNRLGSLPRDALGALPDLRSLRINNNRLRTLAPGTFDALSALSHLQLYH
NPFHCGCGLVWLQAWAASTRVSLPEPDSIACASPPALQGVPVYRLPALPCAPPSVHLSAE
PPLEAPGTPLRAGLAFVLHCIADGHPTPRLQWQLQIPGGTVVLEPPVLSGEDDGVGAEEG
EGEGDGDLLTQTQAQTPTPAPAWPAPPATPRFLALANGSLLVPLLSAKEAGVYTCRAHNE
LGANSTSIRVAVAATGPPKHAPGAGGEPDGQAPTSERKSTAKGRGNSVLPSKPEGKIKGQ
GLAKVSILGETETEPEEDTSEGEEAEDQILADPAEEQRCGNGDPSRYVSNHAFNQSAELK
PHVFELGVIALDVAEREARVQLTPLAARWGPGPGGAGGAPRPGRRPLRLLYLCPAGGGAA
VQWSRVEEGVNAYWFRGLRPGTNYSVCLALAGEACHVQVVFSTKKELPSLLVIVAVSVFL
LVLATVPLLGAACCHLLAKHPGKPYRLILRPQAPDPMEKRIAADFDPRASYLESEKSYPA
GGEAGGEEPEDVQGEGLDEDAEQGDPSGDLQREESLAACSLVESQSKANQEEFEAGSEYS
DRLPLGAEAVNIAQEINGNYRQTAG
Download sequence
Identical sequences A0A2J8KRJ5 Q6UXK2
gi|194306618|ref|NP_001123608.1| gi|194306621|ref|NP_001123609.1| gi|194306623|ref|NP_001123610.1| gi|39930401|ref|NP_065902.1| NP_001123608.1.87134 NP_001123608.1.92137 NP_001123609.1.87134 NP_001123609.1.92137 NP_001123610.1.87134 NP_001123610.1.92137 NP_001289339.1.37143 NP_065902.1.87134 NP_065902.1.92137 XP_003811173.1.60992 XP_003811176.1.60992 XP_008961735.1.60992 XP_008961736.1.60992 XP_008961738.1.60992 XP_011520142.1.92137 XP_011520143.1.92137 XP_016782497.1.37143 XP_016782498.1.37143 XP_016782499.1.37143 XP_016782500.1.37143 XP_016782501.1.37143 XP_016782502.1.37143 NYSGRC-IgSF-ISLR2_HUMAN ENSP00000355402 ENSP00000411443 ENSP00000411834 ENSP00000455531 ENSP00000458080 ENSP00000355402 9606.ENSP00000354217 ENSP00000355402 ENSP00000403244 ENSP00000408872 ENSP00000411443 ENSP00000411834 ENSP00000455531 ENSP00000458080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]