SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|39930571|ref|NP_932341.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|39930571|ref|NP_932341.1|
Domain Number 1 Region: 85-233
Classification Level Classification E-value
Superfamily L domain-like 2.21e-27
Family Internalin LRR domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|39930571|ref|NP_932341.1|
Sequence length 542
Comment leucine-rich repeat-containing protein 56 [Homo sapiens]
Sequence
MDLGWDRSRGPRRSTSSVRVRELSWQGLHNPCPQSKGPGSQRDRLGEQLVEEYLSPARLQ
ALARVDDLRLVRTLEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQV
LWLARCGLADLDGIASLPALKELYASYNNISDLSPLCLLEQLEVLDLEGNSVEDLGQVRY
LQLCPRLAMLTLEGNLVCLQPAPGPTNKVPRGYNYRAEVRKLIPQLQVLDEVPAAHTGPP
APPRLSQDWLAVKEAIKKGNGLPPLDCPRGAPIRRLDPELSLPETQSRASRPWPFSLLVR
GGPLPEGLLSEDLAPEDNTSSLTHGAGQVLCGNPTKGLRERRHQCQAREPPEQLPQHRPG
DPAASTSTPEPDPADSSDFLALAGLRAWREHGVRPLPYRHPESQQEGAVAPWGPRRVPEE
QVHQAEPKTPSSPPSLASEPSGTSSQHLVPSPPKHPRPRDSGSSSPRWSTDLQSRGRRLR
VLGSWGPGLGDGVAAVPVLRALEVASRLSPRAQGCPGPKPAPDAAARPPRAAELSHPSPV
PT
Download sequence
Identical sequences Q8IYG6
9606.ENSP00000270115 NP_932341.1.87134 NP_932341.1.92137 XP_005252832.1.92137 XP_006718195.1.92137 XP_006718196.1.92137 XP_011518177.1.92137 XP_011518178.1.92137 XP_011518179.1.92137 XP_016872656.1.92137 XP_016872657.1.92137 ENSP00000270115 gi|39930571|ref|NP_932341.1| ENSP00000270115 ENSP00000270115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]