SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|40254415|ref|NP_000400.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|40254415|ref|NP_000400.2|
Domain Number 1 Region: 12-171
Classification Level Classification E-value
Superfamily EF-hand 4.61e-44
Family Calmodulin-like 0.0000422
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|40254415|ref|NP_000400.2|
Sequence length 201
Comment guanylyl cyclase-activating protein 1 [Homo sapiens]
Sequence
MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMF
ETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIR
AINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIV
RRLQNGEQDEEGADEAAEAAG
Download sequence
Identical sequences A0A2I3TQU7 P43080
GO.43672 ENSP00000362049 NP_000400.2.87134 NP_000400.2.92137 NP_001305990.1.87134 NP_001305990.1.92137 NP_001305991.1.87134 NP_001305991.1.92137 XP_003833346.1.60992 XP_011512839.1.92137 XP_011512841.1.92137 XP_016810975.1.37143 ENSP00000053469 ENSP00000362049 ENSP00000377784 ENSP00000437476 9606.ENSP00000053469 gi|40254415|ref|NP_000400.2| ENSP00000053469 ENSP00000362049 ENSP00000377784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]