SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|40254924|ref|NP_060979.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|40254924|ref|NP_060979.2|
Domain Number 1 Region: 19-124
Classification Level Classification E-value
Superfamily L domain-like 9.98e-27
Family Ngr ectodomain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|40254924|ref|NP_060979.2|
Sequence length 307
Comment leucine-rich repeat-containing protein 59 [Homo sapiens]
Sequence
MTKAGSKGGNLRDKLDGNELDLSLSDLNEVPVKELAALPKATILDLSCNKLTTLPSDFCG
LTHLVKLDLSKNKLQQLPADFGRLVNLQHLDLLNNKLVTLPVSFAQLKNLKWLDLKDNPL
DPVLAKVAGDCLDEKQCKQCANKVLQHMKAVQADQERERQRRLEVEREAEKKREAKQRAK
EAQERELRKREKAEEKERRRKEYDALKAAKREQEKKPKKEANQAPKSKSGSRPRKPPPRK
HTRSWAVLKLLLLLLLFGVAGGLVACRVTELQQQPLCTSVNTIYDNAVQGLRRHEILQWV
LQTDSQQ
Download sequence
Identical sequences G3SG62 H2QDF0 Q96AG4
ENSP00000225972 ENSP00000225972 NP_060979.2.87134 NP_060979.2.92137 XP_003817501.1.60992 XP_004041379.1.27298 XP_511877.2.37143 ENSGGOP00000027098 ENSPTRP00000015962 ENSPTRP00000015962 9598.ENSPTRP00000015962 9606.ENSP00000225972 gi|40254924|ref|NP_060979.2| ENSGGOP00000006171 ENSP00000225972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]