SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|40254947|ref|NP_066979.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|40254947|ref|NP_066979.2|
Domain Number 1 Region: 32-139
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000128
Family Thioltransferase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|40254947|ref|NP_066979.2|
Sequence length 349
Comment thioredoxin-related transmembrane protein 4 precursor [Homo sapiens]
Sequence
MAGGRCGPQLTALLAAWIAAVAATAGPEEAALPPEQSRVQPMTASNWTLVMEGEWMLKFY
APWCPSCQQTDSEWEAFAKNGEILQISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIFR
RYRGPGIFEDLQNYILEKKWQSVEPLTGWKSPASLTMSGMAGLFSISGKIWHLHNYFTVT
LGIPAWCSYVFFVIATLVFGLFMGLVLVVISECFYVPLPRHLSERSEQNRRSEEAHRAEQ
LQDAEEEKDDSNEEENKDSLVDDEEEKEDLGDEDEAEEEEEEDNLAAGVDEERSEANDQG
PPGEDGVTREEVEPEEAEEGISEQPCPADTEVVEDSLRQRKSQHADKGL
Download sequence
Identical sequences A0A2I2YU05 G2HF19 Q9H1E5
ENSP00000246024 ENSPTRP00000022703 ENSGGOP00000024441 ENSPTRP00000022703 9598.ENSPTRP00000022703 9606.ENSP00000246024 NP_001233435.1.37143 NP_066979.2.87134 NP_066979.2.92137 XP_003821408.1.60992 XP_004061842.1.27298 ENSP00000246024 ENSGGOP00000024441 gi|40254947|ref|NP_066979.2| ENSP00000246024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]