SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|40255047|ref|NP_079203.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|40255047|ref|NP_079203.3|
Domain Number 1 Region: 91-198
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000481
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 2 Region: 508-571,622-653
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000558
Family Second domain of FERM 0.0082
Further Details:      
 
Weak hits

Sequence:  gi|40255047|ref|NP_079203.3|
Domain Number - Region: 400-495
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000165
Family Ras-binding domain, RBD 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|40255047|ref|NP_079203.3|
Sequence length 793
Comment pleckstrin homology domain-containing family H member 3 precursor [Homo sapiens]
Sequence
MPLPGGLWWLLCCRRGFTLLHRDYGDGELSGDGDEDEDEETFELRTPSPAGGGRGPLEVT
LTQPVRSGPVSNRLQSWEETWSLIPEKGLPEDDPDIVVKGWLYREPRGGGARPWLPPRRA
WFVLTRDSLDQFSSSGKGARRLGSLVLTSLCSVTGPERRRKETGLWSVTVSGRKHSVRLC
SPRQAEAERWGVALREVIASKAPLETPTQLLLRDIQESCGDPEAVALIYLRNPILRHTSG
ALYAPLLPLPYGVSAPGPGYAPLREEAVRLFLALQALEGARRPGPLMQGVLQTCRDLPAL
RDELFLQLAKQTSGPAGPPGLPATQDPAALRYWQLLTCMSCTFRPGGAVRGHLLGHLERT
EQALPDSELAEYARFIRKALGRTRGRELVPSLAEISALSQRQELLCTVHCPGAGACAVAI
DSHTTAGEVARELVGRLGLARSRNAFALYEQRGAQERALAGGTLVADVLTRFENLAAEEA
GLEDSPDSGWRLCLRLHGPLHPEGLSPDGHELPFLFEQAHALLLRGRPPPPDDTLRALAA
LRLQSLHRDFSPRVPLPRLDRLLPPPAPPREDPPRPTPRPPPSAALLAGALWSPGLAKRR
AERARRGGAGRTAGSIAREGGGGAGTAAAVLGGWKRLRGMGRAEAMAAYLALAAQCPGFG
AARYDVLELSTEPGRGAPQKLCLGLGAKAMSLSRPGETEPIHSVSYGHVAACQLMGPHTL
ALRVGESQLLLQSPQVEEIMQLVNAYLANPSPERPCSSSSPPCQDLPDTSPPSQRPGLDE
PQGQSGCLGQLQD
Download sequence
Identical sequences NP_079203.3.87134 NP_079203.3.92137 gi|40255047|ref|NP_079203.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]