SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|40255149|ref|NP_694945.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|40255149|ref|NP_694945.2|
Domain Number 1 Region: 357-577
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-53
Family DBL homology domain (DH-domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 716-779
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000119
Family SH3-domain 0.0019
Further Details:      
 
Domain Number 3 Region: 577-700
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000603
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|40255149|ref|NP_694945.2|
Sequence length 802
Comment rho guanine nucleotide exchange factor 19 [Homo sapiens]
Sequence
MDCGPPATLQPHLTGPPGTAHHPVAVCQQESLSFAELPALKPPSPVCLDLFPVAPEELRA
PGSRWSLGTPAPLQGLLWPLSPGGSDTEITSGGMRPSRAGSWPHCPGAQPPALEGPWSPR
HTQPQRRASHGSEKKSAWRKMRVYQREEVPGCPEAHAVFLEPGQVVQEQALSTEEPRVEL
SGSTRVSLEGPERRRFSASELMTRLHSSLRLGRNSAARALISGSGTGAAREGKASGMEAR
SVEMSGDRVSRPAPGDSREGDWSEPRLDTQEEPPLGSRSTNERRQSRFLLNSVLYQEYSD
VASARELRRQQREEEGPGDEAEGAEEGPGPPRANLSPSSSFRAQRSARGSTFSLWQDIPD
VRGSGVLATLSLRDCKLQEAKFELITSEASYIHSLSVAVGHFLGSAELSECLGAQDKQWL
FSKLPEVKSTSERFLQDLEQRLEADVLRFSVCDVVLDHCPAFRRVYLPYVTNQAYQERTY
QRLLLENPRFPGILARLEESPVCQRLPLTSFLILPFQRITRLKMLVENILKRTAQGSEDE
DMATKAFNALKELVQECNASVQSMKRTEELIHLSKKIHFEGKIFPLISQARWLVRHGELV
ELAPLPAAPPAKLKLSSKAVYLHLFNDCLLLSRRKELGKFAVFVHAKMAELQVRDLSLKL
QGIPGHVFLLQLLHGQHMKHQFLLRARTESEKQRWISALCPSSPQEDKEVISEGEDCPQV
QCVRTYKALHPDELTLEKTDILSVRTWTSDGWLEGVRLADGEKGWVPQAYVEEISSLSAR
LRNLRENKRVTSATSKLGEAPV
Download sequence
Identical sequences Q8IW93
NP_694945.2.87134 NP_694945.2.92137 XP_011539008.1.92137 9606.ENSP00000270747 gi|40255149|ref|NP_694945.2| ENSP00000270747 ENSP00000270747 ENSP00000270747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]