SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|40255157|ref|NP_700356.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|40255157|ref|NP_700356.2|
Domain Number 1 Region: 168-462
Classification Level Classification E-value
Superfamily L domain-like 8.5e-55
Family Ngr ectodomain-like 0.065
Further Details:      
 
Domain Number 2 Region: 47-232
Classification Level Classification E-value
Superfamily RNI-like 3.92e-26
Family 28-residue LRR 0.043
Further Details:      
 
Domain Number 3 Region: 603-701
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 4 Region: 687-788
Classification Level Classification E-value
Superfamily Immunoglobulin 7.3e-21
Family I set domains 0.014
Further Details:      
 
Domain Number 5 Region: 498-608
Classification Level Classification E-value
Superfamily Immunoglobulin 3.09e-16
Family I set domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|40255157|ref|NP_700356.2|
Sequence length 1119
Comment leucine-rich repeats and immunoglobulin-like domains protein 3 isoform 2 [Homo sapiens]
Sequence
MSAPSLRARAAGLGLLLCAVLGRAGRSDSGGRGELGQPSGVAAERPCPTTCRCLGDLLDC
SRKRLARLPEPLPSWVARLDLSHNRLSFIKASSMSHLQSLREVKLNNNELETIPNLGPVS
ANITLLSLAGNRIVEILPEHLKEFQSLETLDLSSNNISELQTAFPALQLKYLYLNSNRVT
SMEPGYFDNLANTLLVLKLNRNRISAIPPKMFKLPQLQHLELNRNKIKNVDGLTFQGLGA
LKSLKMQRNGVTKLMDGAFWGLSNMEILQLDHNNLTEITKGWLYGLLMLQELHLSQNAIN
RISPDAWEFCQKLSELDLTFNHLSRLDDSSFLGLSLLNTLHIGNNRVSYIADCAFRGLSS
LKTLDLKNNEISWTIEDMNGAFSGLDKLRRLILQGNRIRSITKKAFTGLDALEHLDLSDN
AIMSLQGNAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQSFVNASCAHPQLLKG
RSIFAVSPDGFVCDDFPKPQITVQPETQSAIKGSNLSFICSAASSSDSPMTFAWKKDNEL
LHDAEMENYAHLRAQGGEVMEYTTILRLREVEFASEGKYQCVISNHFGSSYSVKAKLTVN
MLPSFTKTPMDLTIRAGAMARLECAAVGHPAPQIAWQKDGGTDFPAARERRMHVMPEDDV
FFIVDVKIEDIGVYSCTAQNSAGSISANATLTVLETPSFLRPLLDRTVTKGETAVLQCIA
GGSPPPKLNWTKDDSPLVVTERHFFAAGNQLLIIVDSDVSDAGKYTCEMSNTLGTERGNV
RLSVIPTPTCDSPQMTAPSLDDDGWATVGVVIIAVVCCVVGTSLVWVVIIYHTRRRNEDC
SITNTDETNLPADIPSYLSSQGTLADRQDGYVSSESGSHHQFVTSSGAGFFLPQHDSSGT
CHIDNSSEADVEAATDLFLCPFLGSTGPMYLKGNVYGSDPFETYHTGCSPDPRTVLMDHY
EPSYIKKKECYPCSHPSEESCERSFSNISWPSHVRKLLNTSYSHNEGPGMKNLCLNKSSL
DFSANPEPASVASSNSFMGTFGKALRRPHLDAYSSFGQPSDCQPRAFYLKAHSSPDLDSG
SEEDGKERTDFQEENHICTFKQTLENYRTPNFQSYDLDT
Download sequence
Identical sequences Q6UXM1
NP_700356.2.87134 NP_700356.2.92137 ENSP00000326759 NYSGRC-IgSF-LRIG3_HUMAN ENSP00000326759 gi|40255157|ref|NP_700356.2| 9606.ENSP00000326759 ENSP00000326759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]