SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|40317626|ref|NP_003237.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|40317626|ref|NP_003237.2|
Domain Number 1 Region: 955-1169
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-107
Family Thrombospondin C-terminal domain 0.00000000111
Further Details:      
 
Domain Number 2 Region: 29-233
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.72e-39
Family Laminin G-like module 0.00000000463
Further Details:      
 
Domain Number 3 Region: 832-953
Classification Level Classification E-value
Superfamily TSP type-3 repeat 5.75e-37
Family TSP type-3 repeat 0.000000124
Further Details:      
 
Domain Number 4 Region: 489-546
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 2.49e-17
Family TSP-1 type 1 repeat 0.0000131
Further Details:      
 
Domain Number 5 Region: 435-484
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 3.79e-16
Family TSP-1 type 1 repeat 0.0000342
Further Details:      
 
Domain Number 6 Region: 763-834
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000366
Family TSP type-3 repeat 0.00022
Further Details:      
 
Domain Number 7 Region: 317-374
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000387
Family VWC domain 0.0077
Further Details:      
 
Domain Number 8 Region: 691-775
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000432
Family TSP type-3 repeat 0.00014
Further Details:      
 
Domain Number 9 Region: 379-428
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000144
Family TSP-1 type 1 repeat 0.0008
Further Details:      
 
Domain Number 10 Region: 547-601
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000023
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|40317626|ref|NP_003237.2|
Sequence length 1170
Comment thrombospondin-1 precursor [Homo sapiens]
Sequence
MGLAWGLGVLFLMHVCGTNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFR
IEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVV
SNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELD
VPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLL
TLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRK
VTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSTSCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARE
TKACKKDACPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDVTENQI
CNKQDCPIDGCLSNPCFAGVKCTSYPDGSWKCGACPPGYSGNGIQCTDVDECKEVPDACF
NHNGEHRCENTDPGYNCLPCPPRFTGSQPFGQGVEHATANKQVCKPRNPCTDGTHDCNKN
AKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDKDNCRLVPNPDQKDSDGDGRGDACKDDFDHDSVPDIDDICPENVDISETDFRRF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDLKYECRDP
Download sequence
Identical sequences P07996
ENSP00000260356 gi|40317626|ref|NP_003237.2| ENSP00000260356 ENSP00000260356 9606.ENSP00000260356 NP_003237.2.87134 NP_003237.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]