SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|40317628|ref|NP_003238.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|40317628|ref|NP_003238.2|
Domain Number 1 Region: 957-1171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-103
Family Thrombospondin C-terminal domain 0.00000000419
Further Details:      
 
Domain Number 2 Region: 25-226
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-38
Family Laminin G-like module 0.000016
Further Details:      
 
Domain Number 3 Region: 834-956
Classification Level Classification E-value
Superfamily TSP type-3 repeat 7.72e-35
Family TSP type-3 repeat 0.00000061
Further Details:      
 
Domain Number 4 Region: 766-837
Classification Level Classification E-value
Superfamily TSP type-3 repeat 4.45e-17
Family TSP type-3 repeat 0.00023
Further Details:      
 
Domain Number 5 Region: 493-544
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.7e-16
Family TSP-1 type 1 repeat 0.00012
Further Details:      
 
Domain Number 6 Region: 436-491
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000112
Family TSP-1 type 1 repeat 0.0000813
Further Details:      
 
Domain Number 7 Region: 318-376
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000931
Family VWC domain 0.0047
Further Details:      
 
Domain Number 8 Region: 693-777
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000144
Family TSP type-3 repeat 0.00013
Further Details:      
 
Domain Number 9 Region: 382-430
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000536
Family TSP-1 type 1 repeat 0.00095
Further Details:      
 
Domain Number 10 Region: 549-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000366
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|40317628|ref|NP_003238.2|
Sequence length 1172
Comment thrombospondin-2 precursor [Homo sapiens]
Sequence
MVWRLVLLALWVWPSTQAGHQDKDTTFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRF
DYIPPVNADDLSKITKIMRQKEGFFLTAQLKQDGKSRGTLLALEGPGLSQRQFEIVSNGP
ADTLDLTYWIDGTRHVVSLEDVGLADSQWKNVTVQVAGETYSLHVGCDLIDSFALDEPFY
EHLQAEKSRMYVAKGSARESHFRGLLQNVHLVFENSVEDILSKKGCQQGQGAEINAISEN
TETLRLGPHVTTEYVGPSSERRPEVCERSCEELGNMVQELSGLHVLVNQLSENLKRVSND
NQFLWELIGGPPKTRNMSACWQDGRFFAENETWVVDSCTTCTCKKFKTICHQITCPPATC
ASPSFVEGECCPSCLHSVDGEEGWSPWAEWTQCSVTCGSGTQQRGRSCDVTSNTCLGPSI
QTRACSLSKCDTRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPVPQMGGKNCKGSG
RETKACQGAPCPIDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQYGGKACVGDVQER
QMCNKRSCPVDGCLSNPCFPGAQCSSFPDGSWSCGSCPVGFLGNGTHCEDLDECALVPDI
CFSTSKVPRCVNTQPGFHCLPCPPRYRGNQPVGVGLEAAKTEKQVCEPENPCKDKTHNCH
KHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNLNLVCATNATYHCIKDNC
PHLPNSGQEDFDKDGIGDACDDDDDNDGVTDEKDNCQLLFNPRQADYDKDEVGDRCDNCP
YVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPL
VHNPDQTDVDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNANQADHDRDGQGDACDPDD
DNDGVPDDRDNCRLVFNPDQEDLDGDGRGDICKDDFDNDNIPDIDDVCPENNAISETDFR
NFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDR
DDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVNSTTGTGEHLRN
ALWHTGNTPGQVRTLWHDPRNIGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPI
YDQTYAGGRLGLFVFSQEMVYFSDLKYECRDI
Download sequence
Identical sequences P35442
ENSP00000355751 NP_003238.2.87134 NP_003238.2.92137 9606.ENSP00000355751 ENSP00000355751 ENSP00000482784 gi|40317628|ref|NP_003238.2| ENSP00000355751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]