SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|40548322|ref|NP_954976.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|40548322|ref|NP_954976.1|
Domain Number 1 Region: 352-545
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.02e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000405
Further Details:      
 
Domain Number 2 Region: 157-284
Classification Level Classification E-value
Superfamily PH domain-like 5.04e-19
Family Pleckstrin-homology domain (PH domain) 0.0089
Further Details:      
 
Weak hits

Sequence:  gi|40548322|ref|NP_954976.1|
Domain Number - Region: 74-102
Classification Level Classification E-value
Superfamily WW domain 0.000148
Family WW domain 0.0038
Further Details:      
 
Domain Number - Region: 46-74
Classification Level Classification E-value
Superfamily WW domain 0.00682
Family WW domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|40548322|ref|NP_954976.1|
Sequence length 548
Comment rho GTPase-activating protein 27 isoform a [Homo sapiens]
Sequence
MQPGLSPGSPGDPRPPTPETDYPESLTSYPEEDYSPVGSFGEPGPTSPLTTPPGWSCHVS
QDKQMLYTNHFTQEQWVRLEDPHGKPYFYNPEDSSVRWELPQVPVPAPRSIHKSSQDGDT
PAQASPPEEKVPAELDEVGSWEEVSPATAAVRTKTLDKAGVLHRTKTADKGKRLRKKHWS
ASWTVLEGGVLTFFKDSKTSAAGGLRQPSKFSTPEYTVELRGATLSWAPKDKSSRKNVLE
LRSRDGSEYLIQHDSEAIISTWHKAIAQGIQELSAELPPEESESSRVDFGSSERLGSWQE
KEEDARPNAAAPALGPVGLESDLSKVRHKLRKFLQRRPTLQSLREKGYIKDQVFGCALAA
LCERERSRVPRFVQQCIRAVEARGLDIDGLYRISGNLATIQKLRYKVDHDERLDLDDGRW
EDVHVITGALKLFFRELPEPLFPFSHFRQFIAAIKLQDQARRSRCVRDLVRSLPAPNHDT
LRMLFQHLCRVIEHGEQNRMSVQSVAIVFGPTLLRPEVEETSMPMTMVFQNQVVELILQQ
CADIFPPH
Download sequence
Identical sequences 9606.ENSP00000366121 ENSP00000366121 ENSP00000408235 ENSP00000446550 ENSP00000448920 NP_954976.1.87134 NP_954976.1.92137 gi|40548322|ref|NP_954976.1| ENSP00000366121 ENSP00000478738 ENSP00000480582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]