SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|40807489|ref|NP_001965.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|40807489|ref|NP_001965.3|
Domain Number 1 Region: 227-255,601-872
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000101
Family Rhodopsin-like 0.029
Further Details:      
 
Domain Number 2 Region: 125-252
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000612
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 261-306
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000026
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 4 Region: 74-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000113
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 33-68
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000839
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|40807489|ref|NP_001965.3|
Sequence length 886
Comment EGF-like module-containing mucin-like hormone receptor-like 1 precursor [Homo sapiens]
Sequence
MRGFNLLLFWGCCVMHSWEGHIRPTRKPNTKGNNCRDSTLCPAYATCTNTVDSYYCACKQ
GFLSSNGQNHFKDPGVRCKDIDECSQSPQPCGPNSSCKNLSGRYKCSCLDGFSSPTGNDW
VPGKPGNFSCTDINECLTSSVCPEHSDCVNSMGSYSCSCQVGFISRNSTCEDVDECADPR
ACPEHATCNNTVGNYSCFCNPGFESSSGHLSFQGLKASCEDIDECTEMCPINSTCTNTPG
SYFCTCHPGFAPSNGQLNFTDQGVECRDIDECRQDPSTCGPNSICTNALGSYSCGCIAGF
HPNPEGSQKDGNFSCQRVLFKCKEDVIPDNKQIQQCQEGTAVKPAYVSFCAQINNIFSVL
DKVCENKTTVVSLKNTTESFVPVLKQISTWTKFTKEETSSLATVFLESVESMTLASFWKP
SANITPAVRTEYLDIESKVINKECSEENVTLDLVAKGDKMKIGCSTIEESESTETTGVAF
VSFVGMESVLNERFFKDHQAPLTTSEIKLKMNSRVVGGIMTGEKKDGFSDPIIYTLENIQ
PKQKFERPICVSWSTDVKGGRWTSFGCVILEASETYTICSCNQMANLAVIMASGELTMDF
SLYIISHVGIIISLVCLVLAIATFLLCRSIRNHNTYLHLHLCVCLLLAKTLFLAGIHKTD
NKMGCAIIAGFLHYLFLACFFWMLVEAVILFLMVRNLKVVNYFSSRNIKMLHICAFGYGL
PMLVVVISASVQPQGYGMHNRCWLNTETGFIWSFLGPVCTVIVINSLLLTWTLWILRQRL
SSVNAEVSTLKDTRLLTFKAFAQLFILGCSWVLGIFQIGPVAGVMAYLFTIINSLQGAFI
FLIHCLLNGQVREEYKRWITGKTKPSSQSQTSRILLSSMPSASKTG
Download sequence
Identical sequences Q14246
9606.ENSP00000311545 NP_001965.3.87134 NP_001965.3.92137 gi|40807489|ref|NP_001965.3| ENSP00000250572 ENSP00000311545 ENSP00000311545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]