SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|40807504|ref|NP_940997.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|40807504|ref|NP_940997.1|
Domain Number 1 Region: 11-39,68-84,111-247
Classification Level Classification E-value
Superfamily PH domain-like 9.44e-32
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 
Domain Number 2 Region: 324-436
Classification Level Classification E-value
Superfamily PH domain-like 3.94e-21
Family Pleckstrin-homology domain (PH domain) 0.00031
Further Details:      
 
Weak hits

Sequence:  gi|40807504|ref|NP_940997.1|
Domain Number - Region: 552-641
Classification Level Classification E-value
Superfamily Sec2 N-terminal region 0.00123
Family Sec2 N-terminal region 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|40807504|ref|NP_940997.1|
Sequence length 730
Comment actin filament-associated protein 1 [Homo sapiens]
Sequence
MEELIVELRLFLELLDHEYLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLP
APPQMPLPEIPQPWLPPDSGPPPLPTSSLPEGYYEEAVPLSPGKAPEYITSNYDSDAMSS
SYESYDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTK
LLCYKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTDPLVLAVQSKEQAEQW
LKVIKEAYSGCSGPVDSECPPPPSSPVHKAELEKKLSSERPSSDGEGVVENGITTCNGKE
QVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGYLNVLSNS
RWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAV
LEASSSEDMGRWIGILLAETGSSTDPEALHYDYIDVEMSASVIQTAKQTFCFMNRRVISA
NPYLGGTSNGYAHPSGTALHYDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPA
AVVKRTGSNAAQYKYGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIE
VNAGRKPQAILEEKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPK
SGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAVLKKSQAAPGSSPCRGHVLRK
AKEWELKNGT
Download sequence
Identical sequences Q8N556
ENSP00000351245 ENSP00000353402 ENSP00000351245 ENSP00000353402 NP_940997.1.87134 NP_940997.1.92137 gi|40807504|ref|NP_940997.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]