SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|41152101|ref|NP_653176.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41152101|ref|NP_653176.2|
Domain Number 1 Region: 13-342
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.78e-108
Family Calpain large subunit, catalytic domain (domain II) 0.000000382
Further Details:      
 
Domain Number 2 Region: 347-481
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 4.58e-23
Family Calpain large subunit, middle domain (domain III) 0.0043
Further Details:      
 
Domain Number 3 Region: 494-667
Classification Level Classification E-value
Superfamily EF-hand 4.73e-21
Family Penta-EF-hand proteins 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|41152101|ref|NP_653176.2|
Sequence length 669
Comment calpain-13 [Homo sapiens]
Sequence
MAYYQEPSVETSIIKFKDQDFTTLRDHCLSMGRTFKDETFPAADSSIGQKLLQEKRLSNV
IWKRPQDLPGGPPHFILDDISRFDIQQGGAADCWFLAALGSLTQNPQYRQKILMVQSFSH
QYAGIFRFRFWQCGQWVEVVIDDRLPVQGDKCLFVRPRHQNQEFWPCLLEKAYAKLLGSY
SDLHYGFLEDALVDLTGGVITNIHLHSSPVDLVKAVKTATKAGSLITCATPSGPTDTAQA
MENGLVSLHAYTVTGAEQIQYRRGWEEIISLWNPWGWGEAEWRGRWSDGSQEWEETCDPR
KSQLHKKREDGEFWMSCQDFQQKFIAMFICSEIPITLDHGNTLHEGWSQIMFRKQVILGN
TAGGPRNDAQFNFSVQEPMEGTNVVVCVTVAVTPSNLKAEDAKFPLDFQVILAGSQRFRE
KFPPVFFSSFRNTVQSSNNKFRRNFTMTYHLSPGNYVVVAQTRRKSAEFLLRIFLKMPDS
DRHLSSHFNLRMKGSPSEHGSQQSIFNRYAQQRLDIDATQLQGLLNQELLTGPPGDMFSL
DECRSLVALMELKVNGRLDQEEFARLWKRLVHYQHVFQKVQTSPGVLLSSDLWKAIENTD
FLRGIFISRELLHLVTLRYSDSVGRVSFPSLVCFLMRLEAMAKTFRNLSKDGKGLYLTEM
EWMSLVMYN
Download sequence
Identical sequences Q6MZZ7
ENSP00000403180 gi|41152101|ref|NP_653176.2| ENSP00000295055 9606.ENSP00000295055 NP_653176.2.87134 NP_653176.2.92137 XP_011531461.1.92137 XP_011531462.1.92137 XP_011531463.1.92137 XP_016860753.1.92137 XP_016860754.1.92137 ENSP00000295055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]