SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|41281905|ref|NP_848537.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41281905|ref|NP_848537.1|
Domain Number 1 Region: 364-456
Classification Level Classification E-value
Superfamily PH domain-like 6.58e-19
Family Pleckstrin-homology domain (PH domain) 0.0094
Further Details:      
 
Domain Number 2 Region: 554-642
Classification Level Classification E-value
Superfamily PH domain-like 3.32e-18
Family Third domain of FERM 0.004
Further Details:      
 
Domain Number 3 Region: 250-301
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000393
Family Second domain of FERM 0.0078
Further Details:      
 
Domain Number 4 Region: 467-553
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000236
Family Second domain of FERM 0.0059
Further Details:      
 
Weak hits

Sequence:  gi|41281905|ref|NP_848537.1|
Domain Number - Region: 16-88
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0216
Family Ubiquitin-related 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|41281905|ref|NP_848537.1|
Sequence length 667
Comment fermitin family homolog 3 long form [Homo sapiens]
Sequence
MAGMKTASGDYIDSSWELRVFVGEEDPEAESVTLRVTGESHIGGVLLKIVEQINRKQDWS
DHAIWWEQKRQWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRRALRLRASFSQPL
FQAVAAICRLLSIRHPEELSLLRAPEKKEKKKKEKEPEEELYDLSKVVLAGGVAPALFRG
MPAHFSDSAQTEACYHMLSRPQPPPDPLLLQRLPRPSSLSDKTQLHSRWLDSSRCLMQQG
IKAGDALWLRFKYYSFFDLDPKTDPVRLTQLYEQARWDLLLEEIDCTEEEMMVFAALQYH
INKLSQSGEVGEPAGTDPGLDDLDVALSNLEVKLEGSAPTDVLDSLTTIPELKDHLRIFR
IPRRPRKLTLKGYRQHWVVFKETTLSYYKSQDEAPGDPIQQLNLKGCEVVPDVNVSGQKF
CIKLLVPSPEGMSEIYLRCQDEQQYARWMAGCRLASKGRTMADSSYTSEVQAILAFLSLQ
RTGSGGPGNHPHGPDASAEGLNPYGLVAPRFQRKFKAKQLTPRILEAHQNVAQLSLAEAQ
LRFIQAWQSLPDFGISYVMVRFKGSRKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQW
NVNWDIRQVAIEFDEHINVAFSCVSASCRIVHEYIGGYIFLSTRERARGEELDEDLFLQL
TGGHEAF
Download sequence
Identical sequences A0A2J8QD00 Q86UX7
NP_848537.1.87134 NP_848537.1.92137 XP_011543596.1.92137 ENSP00000339950 gi|41281905|ref|NP_848537.1| ENSPTRP00000041266 NYSGRC-41281905 9606.ENSP00000279227 ENSP00000279227 ENSP00000279227 ENSPTRP00000041266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]