SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|41327730|ref|NP_958434.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41327730|ref|NP_958434.1|
Domain Number 1 Region: 5-189
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.57e-42
Family Calponin-homology domain, CH-domain 0.0000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|41327730|ref|NP_958434.1|
Sequence length 270
Comment calponin-2 isoform b [Homo sapiens]
Sequence
MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTIL
CTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQV
QVSLLALAGKMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHSTISLQMGTNKCASQV
GMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTV
ADGAPSGTGDCPDPGEVPEYPPYYQEEAGY
Download sequence
Identical sequences A0A2J8J2C4 A0A2J8R9Y6
NP_958434.1.87134 NP_958434.1.92137 ENSP00000340129 gi|41327730|ref|NP_958434.1| ENSP00000340129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]