SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|41327732|ref|NP_958439.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41327732|ref|NP_958439.1|
Domain Number 1 Region: 328-520
Classification Level Classification E-value
Superfamily L domain-like 5.39e-47
Family L domain 0.000000145
Further Details:      
 
Domain Number 2 Region: 31-209
Classification Level Classification E-value
Superfamily L domain-like 1.33e-43
Family L domain 0.00000018
Further Details:      
 
Domain Number 3 Region: 505-624
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.51e-23
Family Growth factor receptor domain 0.0000000985
Further Details:      
 
Domain Number 4 Region: 186-339
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.07e-20
Family Growth factor receptor domain 0.0000000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|41327732|ref|NP_958439.1|
Sequence length 628
Comment epidermal growth factor receptor isoform b precursor [Homo sapiens]
Sequence
MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALA
VLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDF
QNHLGSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFK
NCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKL
FGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCN
LLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVM
GENNTLVWKYADAGHVCHLCHPNCTYGS
Download sequence
Identical sequences NP_958439.1.87134 NP_958439.1.92137 ENSP00000342376 gi|41327732|ref|NP_958439.1| ENSP00000342376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]