SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|41327734|ref|NP_958440.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41327734|ref|NP_958440.1|
Domain Number 1 Region: 31-209
Classification Level Classification E-value
Superfamily L domain-like 5.39e-44
Family L domain 0.00000018
Further Details:      
 
Domain Number 2 Region: 186-339
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.78e-20
Family Growth factor receptor domain 0.0000000179
Further Details:      
 
Domain Number 3 Region: 328-403
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000000233
Family L domain 0.0000527
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|41327734|ref|NP_958440.1|
Sequence length 405
Comment epidermal growth factor receptor isoform c precursor [Homo sapiens]
Sequence
MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALA
VLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDF
QNHLGSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFK
NCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGLS
Download sequence
Identical sequences ENSP00000413843 NP_958440.1.87134 NP_958440.1.92137 ENSP00000413843 gi|41327734|ref|NP_958440.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]