SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|41393583|ref|NP_958854.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41393583|ref|NP_958854.1|
Domain Number 1 Region: 137-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000526
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 55-176
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000148
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|41393583|ref|NP_958854.1|
Sequence length 273
Comment epidermal growth factor-like protein 7 [Homo sapiens]
Sequence
MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHR
ACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQP
GRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKG
GPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLL
VHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS
Download sequence
Identical sequences A0A024R8F5 G3RKX9 Q9UHF1
ENSGGOP00000016411 ENSGGOP00000016411 ENSP00000307843 ENSP00000307843 ENSP00000360763 ENSP00000360764 ENSP00000385639 NP_057299.1.87134 NP_057299.1.92137 NP_958854.1.87134 NP_958854.1.92137 XP_004048938.1.27298 XP_004048939.1.27298 XP_011517066.1.92137 XP_011517067.1.92137 XP_011517068.1.92137 ENSP00000307843 ENSP00000360763 ENSP00000360764 ENSP00000385639 gi|41393583|ref|NP_958854.1| gi|7705889|ref|NP_057299.1| 9606.ENSP00000307843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]