SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|41406050|ref|NP_003965.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41406050|ref|NP_003965.2|
Domain Number 1 Region: 144-272
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-36
Family Phosphotyrosine-binding domain (PTB) 0.0002
Further Details:      
 
Domain Number 2 Region: 3-122
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000545
Family Phosphotyrosine-binding domain (PTB) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|41406050|ref|NP_003965.2|
Sequence length 412
Comment docking protein 2 [Homo sapiens]
Sequence
MGDGAVKQGFLYLQQQQTFGKKWRRFGASLYGGSDCALARLELQEGPEKPRRCEAARKVI
RLSDCLRVAEAGGEASSPRDTSAFFLETKERLYLLAAPAAERGDWVQAICLLAFPGQRKE
LSGPEGKQSRPCMEENELYSSAVTVGPHKEFAVTMRPTEASERCHLRGSYTLRAGESALE
LWGGPEPGTQLYDWPYRFLRRFGRDKVTFSFEAGRRCVSGEGNFEFETRQGNEIFLALEE
AISAQKNAAPATPQPQPATIPASLPRPDSPYSRPHDSLPPPSPTTPVPAPRPRGQEGEYA
VPFDAVARSLGKNFRGILAVPPQLLADPLYDSIEETLPPRPDHIYDEPEGVAALSLYDSP
QEPRGEAWRRQATADRDPAGLQHVQPAGQDFSASGWQPGTEYDNVVLKKGPK
Download sequence
Identical sequences O60496
ENSP00000276420 ENSP00000276420 9606.ENSP00000276420 ENSP00000276420 gi|41406050|ref|NP_003965.2| NP_003965.2.87134 NP_003965.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]