SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|41582239|ref|NP_958934.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41582239|ref|NP_958934.1|
Domain Number 1 Region: 35-232
Classification Level Classification E-value
Superfamily L domain-like 7.65e-40
Family Ngr ectodomain-like 0.0051
Further Details:      
 
Domain Number 2 Region: 231-342
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000213
Family I set domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|41582239|ref|NP_958934.1|
Sequence length 428
Comment immunoglobulin superfamily containing leucine-rich repeat protein precursor [Homo sapiens]
Sequence
MQELHLLWWALLLGLAQACPEPCDCGEKYGFQIADCAYRDLESVPPGFPANVTTLSLSAN
RLPGLPEGAFREVPLLQSLWLAHNEIRTVAAGALASLSHLKSLDLSHNLISDFAWSDLHN
LSALQLLKMDSNELTFIPRDAFRSLRALRSLQLNHNRLHTLAEGTFTPLTALSHLQINEN
PFDCTCGIVWLKTWALTTAVSIPEQDNIACTSPHVLKGTPLSRLPPLPCSAPSVQLSYQP
SQDGAELRPGFVLALHCDVDGQPAPQLHWHIQIPSGIVEITSPNVGTDGRALPGTPVASS
QPRFQAFANGSLLIPDFGKLEEGTYSCLATNELGSAESSVDVALATPGEGGEDTLGRRFH
GKAVEGKGCYTVDNEVQPSGPEDNVVIIYLSRAGNPEAAVAEGVPGQLPPGLLLLGQSLL
LFFFLTSF
Download sequence
Identical sequences A0A146E5L3 O14498
ENSP00000249842 ENSP00000249842 ENSP00000378550 9606.ENSP00000249842 NP_005536.1.87134 NP_005536.1.92137 NP_958934.1.87134 NP_958934.1.92137 NYSGRC-IgSF-ISLR_HUMAN O14498 ENSP00000249842 ENSP00000378550 gi|41582239|ref|NP_958934.1| gi|5031809|ref|NP_005536.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]