SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|42476123|ref|NP_055143.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|42476123|ref|NP_055143.2|
Domain Number 1 Region: 377-430
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000669
Family SH3-domain 0.002
Further Details:      
 
Domain Number 2 Region: 17-194
Classification Level Classification E-value
Superfamily RUN domain-like 0.00000000301
Family RUN domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|42476123|ref|NP_055143.2|
Sequence length 433
Comment RUN and SH3 domain-containing protein 1 isoform d [Homo sapiens]
Sequence
MAEAQSGTGQLQEQKKGLLIAVSVSVDKIISHFGAARNLVQKAQLGDSRLSPDVGHLVLT
TLCPALHALVADGLKPFRKDLITGQRRSSPWSVVEASVKPGSSTRSLGTLYSQVSRLAPL
SSSRSRFHAFILGLLNTKQLELWFSSLQEDAGLLSLLYLPTGFFSLARGGCPSLSTELLL
LLQPLSVLTFHLDLLFEHHHHLPLGPPQAPAPPGPPPALQQTMQAMLHFGGRLAQSLRGT
SKEAASDPSDSPNLPTPGSWWEQLTQASRVYASGGTEGFPLSRWAPGRHGTAAEEGAQER
PLPTDEMAPGRGLWLGRLFGVPGGPAENENGALKSRRPSSWLPPTVSVLALVKRGAPPEM
PSPQELEASAPRMVQTHRAVRALCDHTAARPDQLSFRRGEVLRVITTVDEDWLRCGRDGM
EGLVPVGYTSLVL
Download sequence
Identical sequences NP_001265159.1.87134 NP_001265159.1.92137 NP_055143.2.87134 NP_055143.2.92137 XP_006711320.1.92137 ENSP00000292254 ENSP00000357333 ENSP00000292254 ENSP00000357333 GO.35460 gi|42476123|ref|NP_055143.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]