SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|42516576|ref|NP_057501.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|42516576|ref|NP_057501.2|
Domain Number 1 Region: 43-143
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.52e-33
Family Thioltransferase 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|42516576|ref|NP_057501.2|
Sequence length 157
Comment glutaredoxin-related protein 5, mitochondrial precursor [Homo sapiens]
Sequence
MSGSLGRAAAALLRWGRGAGGGGLWGPGVRAAGSGAGGGGSAEQLDALVKKDKVVVFLKG
TPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVG
GCDILLQMHQNGDLVEELKKLGIHSALLDEKKDQDSK
Download sequence
Identical sequences G1QI27 H2Q8V8 Q86SX6
ENSP00000328570 ENSNLEP00000000570 ENSPTRP00000011409 ENSP00000328570 9598.ENSPTRP00000011409 9606.ENSP00000328570 gi|42516576|ref|NP_057501.2| ENSPTRP00000011409 ENSP00000328570 ENSNLEP00000000570 NP_057501.2.87134 NP_057501.2.92137 XP_001154482.1.37143 XP_003275401.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]