SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|42558258|ref|NP_976046.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|42558258|ref|NP_976046.1|
Domain Number 1 Region: 69-135
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000157
Family F-box domain 0.003
Further Details:      
 
Weak hits

Sequence:  gi|42558258|ref|NP_976046.1|
Domain Number - Region: 197-355
Classification Level Classification E-value
Superfamily RNI-like 0.00104
Family 28-residue LRR 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|42558258|ref|NP_976046.1|
Sequence length 555
Comment F-box only protein 33 [Homo sapiens]
Sequence
MLLFLSVPQPRPPGARTRAGAARVARWRRLRLQQLRRLRGLLRVLRGRPGAGSRRRGRMA
LCGQAAGAASLPSELIVHIFSFLPAPDRLRASASCSHWRECLFYPALWPQLRICLRVSPA
EQPRLEFLMRKCGWFVRELRVEFAAENYLSGGGPGDGGGADTGTGGEEVEALQLSARWLE
VLRTYLELVLCVLVSIRNNRNLQKFSLFGDISVLQQQGSLSNTYLSKVDPDGKKIKQIQQ
LFEEILSNSRQLKWLSCGFMLEIVTPTSLSSLSNAVANTMEHLSLLDNNIPGNSTLITAV
ELERFVNLHSLALDFCDFTAEMARVLTDSNHVPLQRLSLLVHNVSVMHKSLDNMPNDEHW
KALSRKSTSFRVYIMAFDIKSEDMLKILKPSIPLERIHFDSYITCVSGAIVDLISRQYDK
FLTHFILMNDVIDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAIARL
RGSDLKVLEVTEESIDFDQGELADQDVDPVHNLIEQVSLGLGQPWHAVMDIESLSVFTEP
NRHFYREMQSFSEDI
Download sequence
Identical sequences Q7Z6M2
NP_976046.1.87134 NP_976046.1.92137 ENSP00000298097 gi|42558258|ref|NP_976046.1| ENSP00000298097 9606.ENSP00000298097 NYSGRC-42558258 ENSP00000298097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]