SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|42717994|ref|NP_001383.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|42717994|ref|NP_001383.2|
Domain Number 1 Region: 17-142
Classification Level Classification E-value
Superfamily EF-hand 5e-38
Family EF-hand modules in multidomain proteins 0.0046
Further Details:      
 
Domain Number 2 Region: 143-236
Classification Level Classification E-value
Superfamily EF-hand 4.31e-31
Family EF-hand modules in multidomain proteins 0.0052
Further Details:      
 
Domain Number 3 Region: 219-297
Classification Level Classification E-value
Superfamily RING/U-box 2.83e-21
Family ZZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|42717994|ref|NP_001383.2|
Sequence length 374
Comment dystrobrevin alpha isoform 7 [Homo sapiens]
Sequence
MIEDSGKRGNTMAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIE
ALRENALNNLDPNTELNVSRLEAVLSTIFYQLNKRMPTTHQIHVEQSISLLLNFLLAAFD
PEGHGKISVFAVKMALATLCGGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTA
VFEGPSFGYTEQSARSCFSQQKKVTLNGFLDTLMSDPPPQCLVWLPLLHRLANVENVFHP
VECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYTSWKSPAKKLT
NALSKSLSCASSREPLHPMFPDQPEKPLNLAHIVDTWPPRPVTSMNDTLFSHSVPSSGSP
FITRSSDGAFGGCV
Download sequence
Identical sequences A0A2I2ZIZ0
ENSP00000322519 NP_001383.2.87134 NP_001383.2.92137 XP_008953954.1.60992 XP_016881089.1.92137 XP_018869588.1.27298 XP_018869589.1.27298 ENSP00000322519 gi|42717994|ref|NP_001383.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]