SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|42740893|ref|NP_976241.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|42740893|ref|NP_976241.1|
Domain Number 1 Region: 314-413
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.88e-32
Family Ras-binding domain, RBD 0.0039
Further Details:      
 
Domain Number 2 Region: 449-561
Classification Level Classification E-value
Superfamily PH domain-like 1.75e-16
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|42740893|ref|NP_976241.1|
Sequence length 644
Comment ras-associated and pleckstrin homology domains-containing protein 1 isoform 3 [Homo sapiens]
Sequence
MEQLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDSDKPMEPVKRSPLRQET
NMANFSYRFSIYNLNEALNQGETVDLDALMADLCSIEQELSSIGSGNSKRQITETKATQK
LPVSRHTLKHGTLKGLSSSSNRIAKPSHASYSLDDVTAQLEQASLSMDEAAQQSVLEDTK
PLVTNQHRRTASAGTVSDAEVHSISNSSHSSITSAASSMDSLDIDKVTRPQELDLTHQGQ
PITEHAISLRCSSKQAKRHIDFTEEQAELTPHSYLDRETSLLLRNIAGKPSHLLTKEEQA
AKLKAEKIRVALEKIKEAQVKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGY
SLDWSLVETVSELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALFKNPQNYLL
GKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYV
PKGKAKVSRDLVCFLQLDHVNVYYGQDYRNKYKAPTDYCLVLKHPQIQKKSQYIKYLCCD
DVRTLHQWVNGIRIAKYGKQLYMNYQEALKRTESAYDWTSLSSSSIKSGSSSSSIPESQS
NHSNQSDSGVSDTQPAGHVRSQSIVSSVFSEAWKRGTQLEESSK
Download sequence
Identical sequences NP_976241.1.87134 NP_976241.1.92137 ENSP00000311293 gi|42740893|ref|NP_976241.1| ENSP00000311293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]