SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|42741650|ref|NP_976086.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|42741650|ref|NP_976086.1|
Domain Number 1 Region: 73-105
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000076
Family Selenoprotein W-related 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|42741650|ref|NP_976086.1|
Sequence length 124
Comment 15 kDa selenoprotein isoform 2 precursor [Homo sapiens]
Sequence
MVAMAAGPSGCLVPAFGLRLLLATVLQAVSAFGAEFSSEACRELGFSSNLLCSSCDLLGQ
FNLLQLDPDCRGCCQEEAQFETKKLYAGAILEVCGUKLGRFPQVQVCPWFRPCIKAFGRQ
WEHC
Download sequence
Identical sequences NP_976086.1.87134 NP_976086.1.92137 XP_008967930.2.60992 gi|42741650|ref|NP_976086.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]