SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|42822891|ref|NP_115715.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|42822891|ref|NP_115715.3|
Domain Number 1 Region: 23-98
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.91e-19
Family Selenoprotein W-related 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|42822891|ref|NP_115715.3|
Sequence length 115
Comment protein C17orf37 [Homo sapiens]
Sequence
MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLG
GTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL
Download sequence
Identical sequences Q9BRT3
ENSP00000377778 ENSP00000377778 gi|42822891|ref|NP_115715.3| NP_115715.3.87134 NP_115715.3.92137 GO.33770 HR2522 9606.ENSP00000377778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]