SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|44921615|ref|NP_787072.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|44921615|ref|NP_787072.2|
Domain Number 1 Region: 330-554
Classification Level Classification E-value
Superfamily Cullin repeat-like 6.8e-60
Family Exocyst complex component 0.0012
Further Details:      
 
Domain Number 2 Region: 180-287
Classification Level Classification E-value
Superfamily PH domain-like 7.74e-28
Family Pleckstrin-homology domain (PH domain) 0.00000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|44921615|ref|NP_787072.2|
Sequence length 725
Comment exocyst complex component 8 [Homo sapiens]
Sequence
MAMAMSDSGASRLRRQLESGGFEARLYVKQLSQQSDGDRDLQEHRQRIQALAEETAQNLK
RNVYQNYRQFIETAREISYLESEMYQLSHLLTEQKSSLESIPLTLLPAAAAAGAAAASGG
EEGVGGAGGRDHLRGQAGFFSTPGGASRDGSGPGEEGKQRTLTTLLEKVEGCRHLLETPG
QYLVYNGDLVEYDADHMAQLQRVHGFLMNDCLLVATWLPQRRGMYRYNALYSLDGLAVVN
VKDNPPMKDMFKLLMFPESRIFQAENAKIKREWLEVLEDTKRALSEKRRREQEEAAAPRG
PPQVTSKATNPFEDDEEEEPAVPEVEEEKVDLSMEWIQELPEDLDVCIAQRDFEGAVDLL
DKLNHYLEDKPSPPPVKELRAKVEERVRQLTEVLVFELSPDRSLRGGPKATRRAVSQLIR
LGQCTKACELFLRNRAAAVHTAIRQLRIEGATLLYIHKLCHVFFTSLLETAREFEIDFAG
TDSGCYSAFVVWARSAMGMFVDAFSKQVFDSKESLSTAAECVKVAKEHCQQLGDIGLDLT
FIIHALLVKDIQGALHSYKEIIIEATKHRNSEEMWRRMNLMTPEALGKLKEEMKSCGVSN
FEQYTGDDCWVNLSYTVVAFTKQTMGFLEEALKLYFPELHMVLLESLVEIILVAVQHVDY
SLRCEQDPEKKAFIRQNASFLYETVLPVVEKRFEEGVGKPAKQLQDLRNASRLIRVNPES
TTSVV
Download sequence
Identical sequences G1SB12 K7CAG4 Q8IYI6
gi|44921615|ref|NP_787072.2| 9606.ENSP00000353564 ENSNLEP00000022706 ENSP00000355605 ENSP00000353564 NP_787072.2.87134 NP_787072.2.92137 XP_003267308.1.23891 ENSNLEP00000022706 ENSP00000355605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]