SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4502199|ref|NP_001648.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4502199|ref|NP_001648.1|
Domain Number 1 Region: 141-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000001
Family EGF-type module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4502199|ref|NP_001648.1|
Sequence length 252
Comment amphiregulin preproprotein [Homo sapiens]
Sequence
MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSG
SEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENT
SDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER
CGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKK
LRQENGNVHAIA
Download sequence
Identical sequences P15514
gi|113415639|ref|XP_001125684.1| gi|4502199|ref|NP_001648.1| ENSP00000379097 ENSP00000370227 9606.ENSP00000264487 9606.ENSP00000370227 ENSP00000264487 ENSP00000370227 ENSP00000379097 NP_001648.1.87134 NP_001648.1.92137 NYSGXRC-13009a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]