SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4502249|ref|NP_003878.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4502249|ref|NP_003878.1|
Domain Number 1 Region: 542-693
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.11e-67
Family Ankyrin repeat 0.0000000435
Further Details:      
 
Domain Number 2 Region: 32-270,303-328
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.44e-67
Family BAR domain 0.0013
Further Details:      
 
Domain Number 3 Region: 420-538
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.14e-39
Family Pyk2-associated protein beta ARF-GAP domain 0.000000744
Further Details:      
 
Domain Number 4 Region: 301-409
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-21
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 
Domain Number 5 Region: 929-1004
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-16
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4502249|ref|NP_003878.1|
Sequence length 1006
Comment arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 isoform a [Homo sapiens]
Sequence
MPDQISVSEFVAETHEDYKAPTASSFTTRTAQCRNTVAAIEEALDVDRMVLYKMKKSVKA
INSSGLAHVENEEQYTQALEKFGGNCVCRDDPDLGSAFLKFSVFTKELTALFKNLIQNMN
NIISFPLDSLLKGDLKGVKGDLKKPFDKAWKDYETKITKIEKEKKEHAKLHGMIRTEISG
AEIAEEMEKERRFFQLQMCEYLLKVNEIKIKKGVDLLQNLIKYFHAQCNFFQDGLKAVES
LKPSIETLSTDLHTIKQAQDEERRQLIQLRDILKSALQVEQKEDSQIRQSTAYSLHQPQG
NKEHGTERNGSLYKKSDGIRKVWQKRKCSVKNGFLTISHGTANRPPAKLNLLTCQVKTNP
EEKKCFDLISHDRTYHFQAEDEQECQIWMSVLQNSKEEALNNAFKGDDNTGENNIVQELT
KEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDV
LGTSELLLAKNIGNAGFNEIMECCLPAEDSVKPNPGSDMNARKDYITAKYIERRYARKKH
ADNAAKLHSLCEAVKTRDIFGLLQAYADGVDLTEKIPLANGHEPDETALHLAVRSVDRTS
LHIVDFLVQNSGNLDKQTGKGSTALHYCCLTDNAECLKLLLRGKASIEIANESGETPLDI
AKRLKHEHCEELLTQALSGRFNSHVHVEYEWRLLHEDLDESDDDMDEKLQPSPNRREDRP
ISFYQLGSNQLQSNAVSLARDAANLAKEKQRAFMPSILQNETYGALLSGSPPPAQPAAPS
TTSAPPLPPRNVGKVQTASSANTLWKTNSVSVDGGSRQRSSSDPPAVHPPLPPLRVTSTN
PLTPTPPPPVAKTPSVMEALSQPSKPAPPGISQIRPPPLPPQPPSRLPQKKPAPGADKST
PLTNKGQPRGPVDLSATEALGPLSNAMVLQPPAPMPRKSQATKLKPKRVKALYNCVADNP
DELTFSEGDVIIVDGEEDQEWWIGHIDGDPGRKGAFPVSFVHFIAD
Download sequence
Identical sequences O43150
gi|4502249|ref|NP_003878.1| ENSP00000281419 ENSP00000281419 9606.ENSP00000281419 ENSP00000281419 NP_003878.1.87134 NP_003878.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]