SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4502461|ref|NP_001720.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4502461|ref|NP_001720.1|
Domain Number 1 Region: 64-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000544
Family EGF-type module 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4502461|ref|NP_001720.1|
Sequence length 178
Comment probetacellulin precursor [Homo sapiens]
Sequence
MDRAARCSGASSLPLLLALALGLVILHCVVADGNSTRSPETNGLLCGDPEENCAATTTQS
KRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQIL
VICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA
Download sequence
Identical sequences A0A0S2Z437 P35070
ENSP00000379092 NP_001720.1.87134 NP_001720.1.92137 XP_011530513.1.92137 ENSP00000379092 ENSP00000454448 ENSP00000379092 ENSP00000454448 9606.ENSP00000312050 gi|4502461|ref|NP_001720.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]