SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4502495|ref|NP_001725.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4502495|ref|NP_001725.1|
Domain Number 1 Region: 425-682
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.06e-73
Family Eukaryotic proteases 0.000000000642
Further Details:      
 
Domain Number 2 Region: 19-131
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-30
Family Spermadhesin, CUB domain 0.000000383
Further Details:      
 
Domain Number 3 Region: 174-287
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.19e-23
Family Spermadhesin, CUB domain 0.0000676
Further Details:      
 
Domain Number 4 Region: 359-429
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000639
Family Complement control module/SCR domain 0.0000102
Further Details:      
 
Domain Number 5 Region: 298-362
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000931
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 6 Region: 127-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000495
Family EGF-type module 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|4502495|ref|NP_001725.1|
Sequence length 688
Comment complement C1s subcomponent precursor [Homo sapiens]
Sequence
MWCIVLFSLLAWVYAEPTMYGEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIE
LSENCAYDSVQIISGDTEEGRLCGQRSSNNPHSPIVEEFQVPYNKLQVIFKSDFSNEERF
TGFAAYYVATDINECTDFVDVPCSHFCNNFIGGYFCSCPPEYFLHDDMKNCGVNCSGDVF
TALIGEIASPNYPKPYPENSRCEYQIRLEKGFQVVVTLRREDFDVEAADSAGNCLDSLVF
VAGDRQFGPYCGHGFPGPLNIETKSNALDIIFQTDLTGQKKGWKLRYHGDPMPCPKEDTP
NSVWEPAKAKYVFRDVVQITCLDGFEVVEGRVGATSFYSTCQSNGKWSNSKLKCQPVDCG
IPESIENGKVEDPESTLFGSVIRYTCEEPYYYMENGGGGEYHCAGNGSWVNEVLGPELPK
CVPVCGVPREPFEEKQRIIGGSDADIKNFPWQVFFDNPWAGGALINEYWVLTAAHVVEGN
REPTMYVGSTSVQTSRLAKSKMLTPEHVFIHPGWKLLEVPEGRTNFDNDIALVRLKDPVK
MGPTVSPICLPGTSSDYNLMDGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEVKV
EKPTADAEAYVFTPNMICAGGEKGMDSCKGDSGGAFAVQDPNDKTKFYAAGLVSWGPQCG
TYGLYTRVKNYVDWIMKTMQENSTPRED
Download sequence
Identical sequences P09871
ENSP00000328173 ENSP00000354057 ENSP00000385035 ENSP00000328173 9606.ENSP00000328173 gi|41393602|ref|NP_958850.1| gi|4502495|ref|NP_001725.1| ENSP00000328173 ENSP00000354057 ENSP00000385035 ENSP00000469899 ENSP00000469947 ENSP00000471707 NP_001725.1.87134 NP_001725.1.92137 NP_958850.1.87134 NP_958850.1.92137 XP_005253817.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]