SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4502565|ref|NP_001740.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4502565|ref|NP_001740.1|
Domain Number 1 Region: 49-266
Classification Level Classification E-value
Superfamily EF-hand 4.54e-65
Family Penta-EF-hand proteins 0.0000000632
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|4502565|ref|NP_001740.1|
Sequence length 268
Comment calpain small subunit 1 [Homo sapiens]
Sequence
MFLVNSFLKGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMR
ILGGVISAISEAAAQYNPEPPPPRTHYSNIEANESEEVRQFRRLFAQLAGDDMEVSATEL
MNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQ
FDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMF
RAFKSLDKDGTGQIQVNIQEWLQLTMYS
Download sequence
Identical sequences H2NYJ9 P04632
9600.ENSPPYP00000011080 9606.ENSP00000246533 ENSPPYP00000011080 ENSP00000246533 ENSP00000464849 ENSP00000246533 ENSP00000464849 NP_001003962.1.87134 NP_001003962.1.92137 NP_001289561.1.87134 NP_001289561.1.92137 NP_001740.1.87134 NP_001740.1.92137 XP_002829147.1.23681 XP_002829148.1.23681 XP_009230760.1.23681 gi|4502565|ref|NP_001740.1| gi|51599151|ref|NP_001003962.1| ENSPPYP00000011080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]