SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|4503481|ref|NP_001395.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4503481|ref|NP_001395.1|
Domain Number 1 Region: 277-437
Classification Level Classification E-value
Superfamily eEF1-gamma domain 2.75e-72
Family eEF1-gamma domain 0.000000016
Further Details:      
 
Domain Number 2 Region: 82-235
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.18e-38
Family Glutathione S-transferase (GST), C-terminal domain 0.0024
Further Details:      
 
Domain Number 3 Region: 1-81
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.32e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4503481|ref|NP_001395.1|
Sequence length 437
Comment elongation factor 1-gamma [Homo sapiens]
Sequence
MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPA
FEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGI
MHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSF
RQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREE
KQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNE
DTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASV
ILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWE
GAFQHVGKAFNQGKIFK
Download sequence
Identical sequences A0A2J8TXS9 H2Q3V7 P26641 Q53YD7
NP_001395.1.87134 NP_001395.1.92137 400233 HR3166 hss001000110.1 ENSP00000331901 ENSP00000331901 gi|4503481|ref|NP_001395.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]